PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g17750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family Dof
Protein Properties Length: 251aa    MW: 27139.9 Da    PI: 6.4996
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g17750.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.2e-39362362
           zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+s+
  Vradi07g17750.1  3 HQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSN 62
                     6899****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-28360IPR003851Zinc finger, Dof-type
PfamPF027011.6E-33460IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.73660IPR003851Zinc finger, Dof-type
PROSITE patternPS013610844IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MNHQALKCPR CDSLNTKFCY YNNYNLSQPR HFCKNCRRYW TKGGVLRNVP VGGGCRKSKR  60
SNKPAKTSDA VPPPPPPDPD HSSSESSSLT AAAAEPVSAP INSDSTNMQE SKLSVPVDPV  120
LETNPLEQGA GDCGGIFSEI GPFTSLIATS TNEPLGFGFG NGLPDASSFQ WQHSKVSSNQ  180
ELKLAESSFL DHTVDLSTLH GKTNHGTFGS LDWQGGADQG LFDLPNTVDH AYWSHTHWSD  240
HDNSSLFHLP *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014506030.10.0PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLA0A0S3R7J30.0A0A0S3R7J3_PHAAN; Uncharacterized protein
STRINGGLYMA05G07460.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-38OBF binding protein 4